Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HFE Peptide - N-terminal region

HFE Peptide - N-terminal region

Product Specifications

Product Name Alternative

HFE1, HH, HLA-H, MGC103790, dJ221C16.10.1, MVCD7, TFQTL2

UniProt

Q30201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HFE Rabbit Polyclonal Antibody (orb579117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000401

Preservative

Lyophilized powder

AA Sequence

MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH3 Protein Vector (Human) (pPM-C-His)
PV055140 500 ng

MLH3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GNPTG, CT (GNPTG, C16orf27, GNPTAG, N-acetylglucosamine-1-phosphotransferase subunit gamma, GlcNAc-1-phosphotransferase subunit gamma, UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma) (Biotin)
MBS6303119-01 0.2 mL

GNPTG, CT (GNPTG, C16orf27, GNPTAG, N-acetylglucosamine-1-phosphotransferase subunit gamma, GlcNAc-1-phosphotransferase subunit gamma, UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma) (Biotin)

Sign In for Pricing
View Details
GNPTG, CT (GNPTG, C16orf27, GNPTAG, N-acetylglucosamine-1-phosphotransferase subunit gamma, GlcNAc-1-phosphotransferase subunit gamma, UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma) (Biotin)
MBS6303119-02 5x 0.2 mL

GNPTG, CT (GNPTG, C16orf27, GNPTAG, N-acetylglucosamine-1-phosphotransferase subunit gamma, GlcNAc-1-phosphotransferase subunit gamma, UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma) (Biotin)

Sign In for Pricing
View Details
Hsa-miR-4502 miRNA Inhibitor
CIH1328-01 10 nmol

Hsa-miR-4502 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4502 miRNA Inhibitor
CIH1328-02 20 nmol

Hsa-miR-4502 miRNA Inhibitor

Sign In for Pricing
View Details
NCALD Overexpression Lysate (Native) - (Dry Ice)
NBL1-13500 0.1 mg

NCALD Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details