Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HJV Peptide - N-terminal region

HJV Peptide - N-terminal region

Product Specifications

Product Name Alternative

JH, HFE2, RGMC, HFE2A

UniProt

Q6ZVN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HJV Rabbit Polyclonal Antibody (orb582096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_973733

Preservative

Lyophilized powder

AA Sequence

SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGPD2 AAV siRNA Pooled Vector
39459161 1.0 µg

RGPD2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human RLBP1 Protein, N-His
AP90914 50 µg

Recombinant Human RLBP1 Protein, N-His

Sign In for Pricing
View Details
Carbonic Anhydrase 9 Antibody
252124 0.1 mg

Carbonic Anhydrase 9 Antibody

Sign In for Pricing
View Details
Integrin Alpha M / CD11b (ITGAM) Antibody
abx139616 0.1 mg

Integrin Alpha M / CD11b (ITGAM) Antibody

Sign In for Pricing
View Details
SYAP1 Recombinant Protein (Human)
RP030709 100 µg

SYAP1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Mouse Monoclonal ATRIP Antibody (OTI5E7) [Allophycocyanin]
NBP2-72271APC 0.1 mL

Mouse Monoclonal ATRIP Antibody (OTI5E7) [Allophycocyanin]

Sign In for Pricing
View Details