Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HJV Peptide - N-terminal region

HJV Peptide - N-terminal region

Product Specifications

Product Name Alternative

JH, HFE2, RGMC, HFE2A

UniProt

Q6ZVN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HJV Rabbit Polyclonal Antibody (orb582096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_973733

Preservative

Lyophilized powder

AA Sequence

SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody
PA89350HU-01 50 µg

Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody
PA89350HU-02 100 µg

Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody
PA89350HU-03 500 µg

Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody
PA89350HU-04 1 mg

Rabbit Anti-Human hnRNP D0 (phospho Ser83) Polyclonal Antibody

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2b - Biotin
CSA2211-01 100 µL

Goat Anti-Mouse IgG2b - Biotin

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2b - Biotin
CSA2211-02 500 μL

Goat Anti-Mouse IgG2b - Biotin

Sign In for Pricing
View Details