Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL1 Peptide - C-terminal region

HHIPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1822, UNQ9245

UniProt

Q96JK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHIPL1 Rabbit Polyclonal Antibody (orb584479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120730

Preservative

Lyophilized powder

AA Sequence

EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Alpha-mannosidase 2 MAN2A1 Antibody
A09184 100 µL

Anti-Alpha-mannosidase 2 MAN2A1 Antibody

Sign In for Pricing
View Details
USP22 Polyclonal Antibody
E916297 100 µL

USP22 Polyclonal Antibody

Sign In for Pricing
View Details
CDC25B (phosphorylated Ser353)
310074 100 µL

CDC25B (phosphorylated Ser353)

Sign In for Pricing
View Details
Anti-TLR2 Antibody Picoband® Fluoro647 Conjugated
A00131-Fluoro647 100 µg/Vial

Anti-TLR2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse Alkaline Phosphatase/ ALPL Protein, His, E.coli-200ug
QP8885-ec-200ug 200ug

Recombinant Mouse Alkaline Phosphatase/ ALPL Protein, His, E.coli-200ug

Sign In for Pricing
View Details
Retinol Binding Protein-4 Human Recombinant, His tag (RBP4 Human, His)
PT_72480-01 2 µg

Retinol Binding Protein-4 Human Recombinant, His tag (RBP4 Human, His)

Sign In for Pricing
View Details