Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL1 Peptide - C-terminal region

HHIPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1822, UNQ9245

UniProt

Q96JK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHIPL1 Rabbit Polyclonal Antibody (orb584479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120730

Preservative

Lyophilized powder

AA Sequence

EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB1 Antibody
A47572-50UL 50 μL

CREB1 Antibody

Sign In for Pricing
View Details
DIAPH2, ID (DIAPH2, DIA, Protein diaphanous homolog 2, Diaphanous-related formin-2) (MaxLight 650) discontinued
034640-ML650 100 µL

DIAPH2, ID (DIAPH2, DIA, Protein diaphanous homolog 2, Diaphanous-related formin-2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Human CHGA Protein, N-His
orb2969270-01 50 µg

Recombinant Human CHGA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CHGA Protein, N-His
orb2969270-02 100 µg

Recombinant Human CHGA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CHGA Protein, N-His
orb2969270-03 1 mg

Recombinant Human CHGA Protein, N-His

Sign In for Pricing
View Details
APC Anti-Human CD1a Antibody (OKT-6)
APC-30093-01 20 Tests

APC Anti-Human CD1a Antibody (OKT-6)

Sign In for Pricing
View Details