Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD14B Peptide - C-terminal region

MFSD14B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIATL1

UniProt

Q5SR56

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD14B Rabbit Polyclonal Antibody (orb584624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115947

Preservative

Lyophilized powder

AA Sequence

GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6'-Hydroxy buspirone
FH23929-01 1 mg

6'-Hydroxy buspirone

Sign In for Pricing
View Details
6'-Hydroxy buspirone
FH23929-02 2 mg

6'-Hydroxy buspirone

Sign In for Pricing
View Details
6'-Hydroxy buspirone
FH23929-03 5 mg

6'-Hydroxy buspirone

Sign In for Pricing
View Details
6'-Hydroxy buspirone
FH23929-04 10 mg

6'-Hydroxy buspirone

Sign In for Pricing
View Details
6'-Hydroxy buspirone
FH23929-05 25 mg

6'-Hydroxy buspirone

Sign In for Pricing
View Details
Vibrio Parahemolyticus Polar flagellin B/D Antibody, APC Conjugated
bs-8876R-APC 100 µL

Vibrio Parahemolyticus Polar flagellin B/D Antibody, APC Conjugated

Sign In for Pricing
View Details