Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD14B Peptide - C-terminal region

MFSD14B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIATL1

UniProt

Q5SR56

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD14B Rabbit Polyclonal Antibody (orb584624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115947

Preservative

Lyophilized powder

AA Sequence

GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Uncharacterized Protein KIAA1462 (KIAA1462) ELISA Kit
MBS9932069 Inquire

Cavy Uncharacterized Protein KIAA1462 (KIAA1462) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal HUWE1 Antibody [PerCP]
NBP1-76795PCP 0.1 mL

Rabbit Polyclonal HUWE1 Antibody [PerCP]

Sign In for Pricing
View Details
IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)
TMPY-02325-01 5 µg

IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)
TMPY-02325-02 10 µg

IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)
TMPY-02325-03 20 µg

IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)
TMPY-02325-04 50 µg

IL-10R beta/IL-10RB Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details