Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIC2 Peptide - C-terminal region

HIC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRG22, KIAA1020, ZBTB30, ZNF907

UniProt

Q96JB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055909

Preservative

Lyophilized powder

AA Sequence

FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
MBS9908027-01 48 Well

Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit

Sign In for Pricing
View Details
Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
MBS9908027-02 96 Well

Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit

Sign In for Pricing
View Details
Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
MBS9908027-03 5x 96 Well

Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit

Sign In for Pricing
View Details
Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
MBS9908027-04 10x 96 Well

Canine Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit

Sign In for Pricing
View Details
WARS Protein Lysate (Human) with C-Ha Tag
50251031 100 µg

WARS Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
LentimiRa-hsa-miR-6769a-5p Vector
mh42413 500 ng

LentimiRa-hsa-miR-6769a-5p Vector

Sign In for Pricing
View Details