Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK1 Peptide - middle region

HK1 Peptide - middle region

Product Specifications

Product Name Alternative

HK1-ta, HK1-tb, HK1-tc, HKI, HXK1

UniProt

P19367

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HK1 Rabbit Polyclonal Antibody (orb331117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_277033

Preservative

Lyophilized powder

AA Sequence

ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGM1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62730R-BF680-01 20 µL

PGM1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
PGM1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62730R-BF680-02 100 µL

PGM1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit anti-MKK4 (pS80) Antibody
MBS4512971-01 0.05 mL

Rabbit anti-MKK4 (pS80) Antibody

Sign In for Pricing
View Details
Rabbit anti-MKK4 (pS80) Antibody
MBS4512971-02 0.1 mL

Rabbit anti-MKK4 (pS80) Antibody

Sign In for Pricing
View Details
Rabbit anti-MKK4 (pS80) Antibody
MBS4512971-03 5x 0.1 mL

Rabbit anti-MKK4 (pS80) Antibody

Sign In for Pricing
View Details
Protein S100-A4
orb1637662-01 50 µg

Protein S100-A4

Sign In for Pricing
View Details