HK1 Peptide - middle region
HK1 Peptide - middle region
Product Specifications
Product Name Alternative
HK1-ta, HK1-tb, HK1-tc, HKI, HXK1
UniProt
P19367
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HK1 Rabbit Polyclonal Antibody (orb331117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_277033
Preservative
Lyophilized powder
AA Sequence
ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PCT0845-500MG 500 mg
N-1-Naphthylphthalamic acid (NPA) Plant Culture Tested
Sign In for Pricing
View Details 
MBS6352357-01 0.2 mL
STX4, ID (STX4, STX4A, Syntaxin-4, Renal carcinoma antigen NY-REN-31) (AP)
Sign In for Pricing
View Details MBS6352357-02 5x 0.2 mL
STX4, ID (STX4, STX4A, Syntaxin-4, Renal carcinoma antigen NY-REN-31) (AP)
Sign In for Pricing
View Details 