Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK2 Peptide - middle region

HK2 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686M1669, HKII, HXK2

UniProt

P52789

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HK2 Rabbit Polyclonal Antibody (orb330744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000180

Preservative

Lyophilized powder

AA Sequence

QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGV Polyprotein Rabbit Polyclonal Antibody (HRP)
orb469965 100 µL

HGV Polyprotein Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
EFCAB5 Protein Lysate (Mouse) with C-HA Tag
18998034 100 µg

EFCAB5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral human TOMM22 shRNA (UAS) - Lentiviral human TOMM22 shRNA (UAS, GFP) (100)
GTR15097377 1 Vial

Lentiviral human TOMM22 shRNA (UAS) - Lentiviral human TOMM22 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
X-β-D-fucopyranoside (Highly Pure)
B2016222 25 mg

X-β-D-fucopyranoside (Highly Pure)

Sign In for Pricing
View Details
Lysosome Associated Membrane Protein 2 (LAMP 2, Lgp2, Lgp110) discontinued. see L9190-12L
L9190-11-01 50 µL

Lysosome Associated Membrane Protein 2 (LAMP 2, Lgp2, Lgp110) discontinued. see L9190-12L

Sign In for Pricing
View Details
Lysosome Associated Membrane Protein 2 (LAMP 2, Lgp2, Lgp110) discontinued. see L9190-12L
L9190-11-02 200 µL

Lysosome Associated Membrane Protein 2 (LAMP 2, Lgp2, Lgp110) discontinued. see L9190-12L

Sign In for Pricing
View Details