Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK2 Peptide - middle region

HK2 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686M1669, HKII, HXK2

UniProt

P52789

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HK2 Rabbit Polyclonal Antibody (orb330744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000180

Preservative

Lyophilized powder

AA Sequence

QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH4A1, ID (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) (MaxLight 405) discontinued
A1334-35C-ML405 100 µL

ALDH4A1, ID (Aldehyde Dehydrogenase Family 4 Member A1, Delta-1-pyrroline-5-carboxylate Dehydrogenase, Mitochondrial, P5C Dehydrogenase, ALDH4, P5CDH) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ROC2 (RNF7) (NM_014245) Human Over-expression Lysate
LC402297 20 µg

ROC2 (RNF7) (NM_014245) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti TGFBR1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (Western Blot) 200ul
IRBAMLTGFBR1AP130200UL 200 µL

Rabbit Anti TGFBR1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (Western Blot) 200ul

Sign In for Pricing
View Details
Mouse Pannexin-1, Panx1 ELISA KIT
ELI-43227m 96 Tests

Mouse Pannexin-1, Panx1 ELISA KIT

Sign In for Pricing
View Details
Mouse Human CD11b (FITC)
MBS8559452-01 0.1 mL

Mouse Human CD11b (FITC)

Sign In for Pricing
View Details
Mouse Human CD11b (FITC)
MBS8559452-02 0.1 mL (AF405L)

Mouse Human CD11b (FITC)

Sign In for Pricing
View Details