Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-C Peptide - C-terminal region

HLA-C Peptide - C-terminal region

Product Specifications

Product Name Alternative

D6S204, FLJ27082, HLA-Cw, HLA-Cw12, HLA-JY3, HLC-C, PSORS1

UniProt

Q29960

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-C Rabbit Polyclonal Antibody (orb585512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002108

Preservative

Lyophilized powder

AA Sequence

PPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBS 1X, pH 7.4 solution
GB4757-500ml 500 mL

PBS 1X, pH 7.4 solution

Sign In for Pricing
View Details
Q-VD(OMe)-OPh
A8165-S Evaluation Sample

Q-VD(OMe)-OPh

Sign In for Pricing
View Details
Calponin-3 (CNN3) Antibody
abx111337 100 µL

Calponin-3 (CNN3) Antibody

Sign In for Pricing
View Details
Mmu-miR-12178-5p inhibitor
HY-RI02590-01 5 nmol

Mmu-miR-12178-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-12178-5p inhibitor
HY-RI02590-02 20 nmol

Mmu-miR-12178-5p inhibitor

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi C UPF0194 membrane protein ybhG (ybhG)
MBS1175499-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi C UPF0194 membrane protein ybhG (ybhG)

Sign In for Pricing
View Details