Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-C Peptide - C-terminal region

HLA-C Peptide - C-terminal region

Product Specifications

Product Name Alternative

D6S204, FLJ27082, HLA-Cw, HLA-Cw12, HLA-JY3, HLC-C, PSORS1

UniProt

Q29960

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-C Rabbit Polyclonal Antibody (orb585512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002108

Preservative

Lyophilized powder

AA Sequence

PPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant VACV L2R Protein (aa 1-87)
VAng-Lsx0533-inquire Inquire

Recombinant VACV L2R Protein (aa 1-87)

Sign In for Pricing
View Details
Histone H3 [JJ090-07] Antibody
OM637687-01 100 µL

Histone H3 [JJ090-07] Antibody

Sign In for Pricing
View Details
Histone H3 [JJ090-07] Antibody
OM637687-02 20 µL

Histone H3 [JJ090-07] Antibody

Sign In for Pricing
View Details
Histone H3 [JJ090-07] Antibody
OM637687-03 50 µL

Histone H3 [JJ090-07] Antibody

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis atpH Protein (aa 1-179)
VAng-Lsx4636-1mgEcoli 1 mg (E. coli)

Recombinant Bordetella Parapertussis atpH Protein (aa 1-179)

Sign In for Pricing
View Details
Human GAD-Ab (GAD-Ab) ELISA Kit
YP-W18635-01 48 Tests

Human GAD-Ab (GAD-Ab) ELISA Kit

Sign In for Pricing
View Details