Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMA Peptide - N-terminal region

HLA-DMA Peptide - N-terminal region

Product Specifications

Product Name Alternative

D6S222E, DMA, HLADM, RING6

UniProt

Q31604

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DMA Rabbit Polyclonal Antibody (orb584950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006111

Preservative

Lyophilized powder

AA Sequence

GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF488A conjugate, 0.1mg/mL
BNC882242-100 1x 100 µL

Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLI-3 Antibody
8C10328-AAT 50 µg

GLI-3 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS632641 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
AP17431PU-N 400 µL

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cdk4 Recombinant Rabbit Monoclonal Antibody [SD20-42]
ET1612-1 100 µL

Cdk4 Recombinant Rabbit Monoclonal Antibody [SD20-42]

Sign In for Pricing
View Details
STAT3 Rabbit Polyclonal Antibody
AP06327PU-N 100 µg

STAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details