Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DRB3 Peptide - C-terminal region

HLA-DRB3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HLA-DR3B, HLA-DR52, HLA-DRB1, MGC117330

UniProt

P13762

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DRB3 Rabbit Polyclonal Antibody (orb585678) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_072049

Preservative

Lyophilized powder

AA Sequence

GFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5C2 Polyclonal Antibody
E-AB-90280-01 60 µL

NT5C2 Polyclonal Antibody

Sign In for Pricing
View Details
NT5C2 Polyclonal Antibody
E-AB-90280-02 120 µL

NT5C2 Polyclonal Antibody

Sign In for Pricing
View Details
NT5C2 Polyclonal Antibody
E-AB-90280-03 200 µL

NT5C2 Polyclonal Antibody

Sign In for Pricing
View Details
TGIF (TGIF1) (NM_001278684) Human Tagged ORF Clone
RG237074 10 µg

TGIF (TGIF1) (NM_001278684) Human Tagged ORF Clone

Sign In for Pricing
View Details
Scp2d1 (NM_025490) Mouse Tagged ORF Clone
MG201497 10 µg

Scp2d1 (NM_025490) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human THOC3 activation kit by CRISPRa
GA113515 1 Kit

Human THOC3 activation kit by CRISPRa

Sign In for Pricing
View Details