Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-E Peptide - middle region

HLA-E Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686P19218, EA1.2, EA2.1, HLA-6.2, MHC, QA1

UniProt

P13747

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-E Rabbit Polyclonal Antibody (orb585438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005507

Preservative

Lyophilized powder

AA Sequence

DTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPSD1 Recombinant Protein (Human)
RP102596 100 µg

TPSD1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit anti-human FK506 binding protein like polyclonal Antibody
MBS716321-01 0.1 mL

Rabbit anti-human FK506 binding protein like polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human FK506 binding protein like polyclonal Antibody
MBS716321-02 5x 0.1 mL

Rabbit anti-human FK506 binding protein like polyclonal Antibody

Sign In for Pricing
View Details
TAF1A siRNA (Rat)
orb1828138-01 15 nmol

TAF1A siRNA (Rat)

Sign In for Pricing
View Details
TAF1A siRNA (Rat)
orb1828138-02 30 nmol

TAF1A siRNA (Rat)

Sign In for Pricing
View Details
Borane-​triphenylphosphine Complex
443355-01 1 g

Borane-​triphenylphosphine Complex

Sign In for Pricing
View Details