Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-G Peptide - C-terminal region

HLA-G Peptide - C-terminal region

Product Specifications

Product Name Alternative

MHC-G

UniProt

P17693

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-G Rabbit Polyclonal Antibody (orb585531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002118

Preservative

Lyophilized powder

AA Sequence

HPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF740 conjugate, 0.1mg/mL
BNC742340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Zkscan5 activation kit by CRISPRa
GA204727 1 Kit

Mouse Zkscan5 activation kit by CRISPRa

Sign In for Pricing
View Details
Ku70 (XRCC6) Human Gene Knockout Kit (CRISPR)
KN204048BN 1 Kit

Ku70 (XRCC6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pyronin Y *CAS 92-32-0*
61-AAT 100 mg

Pyronin Y *CAS 92-32-0*

Sign In for Pricing
View Details
Czib Mouse Gene Knockout Kit (CRISPR)
KN500010 1 Kit

Czib Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1 kb DNA Ladder in TE buffer
#31080 1x 500 µL

1 kb DNA Ladder in TE buffer

Sign In for Pricing
View Details