Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-G Peptide - C-terminal region

HLA-G Peptide - C-terminal region

Product Specifications

Product Name Alternative

MHC-G

UniProt

P17693

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-G Rabbit Polyclonal Antibody (orb585531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002118

Preservative

Lyophilized powder

AA Sequence

HPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solution Reservoir
P7025-5S 200 Units/Case

Solution Reservoir

Sign In for Pricing
View Details
IRAK4 Mouse Monoclonal Antibody [Clone ID: 2H9]
AM06659SU-N 100 µL

IRAK4 Mouse Monoclonal Antibody [Clone ID: 2H9]

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), 0.2mg/mL
BNUB2571-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), 0.2mg/mL

Sign In for Pricing
View Details
Fibrinogen gamma Chain Antibody (Biotin)
KB-1685-01 50 μL

Fibrinogen gamma Chain Antibody (Biotin)

Sign In for Pricing
View Details
Fibrinogen gamma Chain Antibody (Biotin)
KB-1685-02 100 µL

Fibrinogen gamma Chain Antibody (Biotin)

Sign In for Pricing
View Details
Fibrinogen gamma Chain Antibody (Biotin)
KB-1685-03 1 mL

Fibrinogen gamma Chain Antibody (Biotin)

Sign In for Pricing
View Details