Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLF Peptide - C-terminal region

HLF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC33822

UniProt

Q16534

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLF Rabbit Polyclonal Antibody (orb576529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002117

Preservative

Lyophilized powder

AA Sequence

NNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR15 Lentiviral Activation Particles (h)
sc-411633-LAC 200 µL

MTMR15 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
C1GALT1C1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14107111 3x 1.0 µg

C1GALT1C1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EVL (C-12) : m-IgG Fc BP-HRP Bundle
sc-529565 1 Kit

EVL (C-12) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Mouse Monoclonal ADAM10 Antibody (MM0077-6D31) [DyLight 488]
NBP2-12014G 0.1 mL

Mouse Monoclonal ADAM10 Antibody (MM0077-6D31) [DyLight 488]

Sign In for Pricing
View Details
PDE7B Recombinant Protein (Mouse)
RP161003 100 µg

PDE7B Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Factor B Rabbit Polyclonal Antibody (AP)
orb1010729 100 µL

Factor B Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details