Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLF Peptide - C-terminal region

HLF Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC33822

UniProt

Q16534

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLF Rabbit Polyclonal Antibody (orb576529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002117

Preservative

Lyophilized powder

AA Sequence

NNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhdc2 3'UTR Lenti-reporter-Luc Vector
25764084 1.0 µg

Klhdc2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PACAP receptor Polyclonal Antibody, APC Conjugated
bs-23149R-APC 100 µL

PACAP receptor Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2026017-01 0.1 mL

Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details
Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2026017-02 0.2 mL

Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details
Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2026017-03 0.5 mL

Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details
Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)
MBS2026017-04 1 mL

Polyclonal Antibody to Extracellular Matrix Metalloproteinase Inducer (EMMPRIN)

Sign In for Pricing
View Details