Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLX Peptide - middle region

HLX Peptide - middle region

Product Specifications

Product Name Alternative

HB24, HLX1

UniProt

Q14774

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLX Rabbit Polyclonal Antibody (orb583829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068777

Preservative

Lyophilized powder

AA Sequence

WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT2 pThr202 Rabbit Polyclonal Antibody
AP09492PU-N 100 µL

SYT2 pThr202 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-(2'-Deoxy-5'-O-DMT-3'-O-nitrophenylsulphonyl-b-D-lyxofuranosyl)thymine
TRC-D210870-500MG 500 mg

1-(2'-Deoxy-5'-O-DMT-3'-O-nitrophenylsulphonyl-b-D-lyxofuranosyl)thymine

Sign In for Pricing
View Details
NUDT6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F12]
TA502335BM 100 µL

NUDT6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F12]

Sign In for Pricing
View Details
Claudin 1 Antibody
8C0142-AAT 50 µg

Claudin 1 Antibody

Sign In for Pricing
View Details
FAM70A (TMEM255A) (NM_001104544) Human Over-expression Lysate
LY426199 100 µg

FAM70A (TMEM255A) (NM_001104544) Human Over-expression Lysate

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF568 conjugate, 0.1mg/mL
BNC682489-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details