Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLX Peptide - middle region

HLX Peptide - middle region

Product Specifications

Product Name Alternative

HB24, HLX1

UniProt

Q14774

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLX Rabbit Polyclonal Antibody (orb583829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068777

Preservative

Lyophilized powder

AA Sequence

WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041L-01 20 Tests

Elab Fluor® 488 Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041L-02 100 Tests

Elab Fluor® 488 Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
Phospho-Tau (S396) Recombinant Rabbit Monoclonal Antibody [SN62-09]
ET1611-68 100 µL

Phospho-Tau (S396) Recombinant Rabbit Monoclonal Antibody [SN62-09]

Sign In for Pricing
View Details
Human Myotilin (MYOT) activation kit by CRISPRa
GA106349 1 Kit

Human Myotilin (MYOT) activation kit by CRISPRa

Sign In for Pricing
View Details
N-Boc-3-ethyl L-Norvaline
TRC-B655400-250MG 250 mg

N-Boc-3-ethyl L-Norvaline

Sign In for Pricing
View Details