Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGA1 Peptide - N-terminal region

HMGA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMG-R, HMGA1A, HMGIY, MGC12816, MGC4242, MGC4854

UniProt

Q5T6U8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMGA1 Rabbit Polyclonal Antibody (orb576532) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002122

Preservative

Lyophilized powder

AA Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 (DG1/447), CF647 conjugate, 0.1mg/mL
BNC470447-100 1x 100 µL

DOG-1 (DG1/447), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPA70 (RPA1) (NM_002945) Human Over-expression Lysate
LY401030 100 µg

RPA70 (RPA1) (NM_002945) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227T-01 50 Tests

Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227T-02 100 Tests

Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227T-03 2x 100 Tests

Elab Fluor® Violet 610 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS642339 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details