Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGA1 Peptide - N-terminal region

HMGA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMG-R, HMGA1A, HMGIY, MGC12816, MGC4242, MGC4854

UniProt

Q5T6U8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMGA1 Rabbit Polyclonal Antibody (orb576532) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002122

Preservative

Lyophilized powder

AA Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CYFIP1 Antibody
RC-4995-01 50 μL

Recombinant CYFIP1 Antibody

Sign In for Pricing
View Details
Recombinant CYFIP1 Antibody
RC-4995-02 100 µL

Recombinant CYFIP1 Antibody

Sign In for Pricing
View Details
Recombinant CYFIP1 Antibody
RC-4995-03 1 mL

Recombinant CYFIP1 Antibody

Sign In for Pricing
View Details
SHANK2 (Center) Rabbit Polyclonal Antibody
AP53906PU-N 400 µL

SHANK2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD16 (FCGR3A) (NM_001127593) Human Over-expression Lysate
LC426815 20 µg

CD16 (FCGR3A) (NM_001127593) Human Over-expression Lysate

Sign In for Pricing
View Details
NSUN6 (NM_182543) Human Recombinant Protein
TP307817L 1 mg

NSUN6 (NM_182543) Human Recombinant Protein

Sign In for Pricing
View Details