Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT Peptide - N-terminal region

HNMT Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMT, HNMT-S1, HNMT-S2

UniProt

P50135

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNMT Rabbit Polyclonal Antibody (orb584395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008826

Preservative

Lyophilized powder

AA Sequence

PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMM50 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62522R-APC-Cy5.5 100 µL

SAMM50 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral human OR52L1 sgRNA gene knockout kit - Lentiviral human OR52L1 sgRNA gene knockout kit (plasmid)
GTR15392834 1 Vial

Lentiviral human OR52L1 sgRNA gene knockout kit - Lentiviral human OR52L1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
COLEC12 Human siRNA Oligo Duplex (Locus ID 81035)
SR325161 1 Kit

COLEC12 Human siRNA Oligo Duplex (Locus ID 81035)

Sign In for Pricing
View Details
UCK (UCK1) Human qPCR Primer Pair (NM_031432)
HP215581 200 Reactions

UCK (UCK1) Human qPCR Primer Pair (NM_031432)

Sign In for Pricing
View Details
CCDC113 (NM_001142302) Human Tagged Lenti ORF Clone
RC226834L4 10 µg

CCDC113 (NM_001142302) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
H-KLTPLCVTL-OH
PP46290-01 1 mg

H-KLTPLCVTL-OH

Sign In for Pricing
View Details