HNRNPU Peptide - C-terminal region
HNRNPU Peptide - C-terminal region
Product Specifications
Product Name Alternative
HNRPU, SAF-A, U21.1, hnRNP U
UniProt
Q00839
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HNRNPU Rabbit Polyclonal Antibody (orb577638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114032
Preservative
Lyophilized powder
AA Sequence
EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MGB07F2-CON A 10x 96 Well Plates
Concanavalin A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
Sign In for Pricing
View Details 
#92500 1 Kit
Mix-n-StainTM Biotin Nanobody Labeling Kit, 1x (5-20ug) labeling
Sign In for Pricing
View Details 