Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPU Peptide - C-terminal region

HNRNPU Peptide - C-terminal region

Product Specifications

Product Name Alternative

HNRPU, SAF-A, U21.1, hnRNP U

UniProt

Q00839

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPU Rabbit Polyclonal Antibody (orb577638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114032

Preservative

Lyophilized powder

AA Sequence

EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 Antibody
KC-3825-01 50 μL

CD59 Antibody

Sign In for Pricing
View Details
CD59 Antibody
KC-3825-02 100 µL

CD59 Antibody

Sign In for Pricing
View Details
CD59 Antibody
KC-3825-03 1 mL

CD59 Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-2073-01 50 μL

MNDA Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-2073-02 100 µL

MNDA Antibody

Sign In for Pricing
View Details
MNDA Antibody
KC-2073-03 1 mL

MNDA Antibody

Sign In for Pricing
View Details