Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOMER3 Peptide - N-terminal region

HOMER3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HOMER-3, VESL3

UniProt

Q9NSC5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOMER3 Rabbit Polyclonal Antibody (orb585249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139193

Preservative

Lyophilized powder

AA Sequence

DSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA Class I ABC Mouse Monoclonal Antibody [Clone ID: W6/32]
AM03005RP-N 100 µg

HLA Class I ABC Mouse Monoclonal Antibody [Clone ID: W6/32]

Sign In for Pricing
View Details
CD4 Recombinant Rabbit monoclonal Antibody [ST0488]
ET1609-52-50UL 50 µL

CD4 Recombinant Rabbit monoclonal Antibody [ST0488]

Sign In for Pricing
View Details
ZFYVE16 Polyclonal Antibody
E-AB-90588-01 60 µL

ZFYVE16 Polyclonal Antibody

Sign In for Pricing
View Details
ZFYVE16 Polyclonal Antibody
E-AB-90588-02 120 µL

ZFYVE16 Polyclonal Antibody

Sign In for Pricing
View Details
ZFYVE16 Polyclonal Antibody
E-AB-90588-03 200 µL

ZFYVE16 Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Urtica dioica Lectin (Stinging Nettle) -UDA-, 1mL 10nm
GP-8005-10 1 mL

Colloidal Gold Conjugated Urtica dioica Lectin (Stinging Nettle) -UDA-, 1mL 10nm

Sign In for Pricing
View Details