Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOMER3 Peptide - N-terminal region

HOMER3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HOMER-3, VESL3

UniProt

Q9NSC5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOMER3 Rabbit Polyclonal Antibody (orb585249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001139193

Preservative

Lyophilized powder

AA Sequence

DSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® HL PHB
HL12013.5G 5 g

TentaGel® HL PHB

Sign In for Pricing
View Details
Ahsa2 Rabbit Polyclonal Antibody
TA363390 100 µL

Ahsa2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F-spondin Recombinant Rabbit monoclonal Antibody
HA750837 100 µL

F-spondin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MURF1 Recombinant Rabbit monoclonal Antibody
HA723973 100 µL

MURF1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), 1mg/mL
BNUM1324-50 1x 50 µL

MLH1 (MutL Homolog 1) (MLH1/1324), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS625163 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details