HOM-TES-103 Peptide - C-terminal region
HOM-TES-103 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp586I2223, FLJ20703, HOM-TES-103, IFFO, MGC117359
UniProt
Q0D2I5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HOM-TES-103 Rabbit Polyclonal Antibody (orb325991) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_542769
Preservative
Lyophilized powder
AA Sequence
VQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400460-100 1x 100 µL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 