Hoxa1 Peptide - C-terminal region
Hoxa1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ERA1, Hox-1.6
UniProt
B9EHK7
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hoxa1 Rabbit Polyclonal Antibody (orb329906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034579
Preservative
Lyophilized powder
AA Sequence
ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2053706 1.0 µg DNA
RPS26P55 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details MBS6382554-01 0.1 mL
IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (Biotin)
Sign In for Pricing
View Details MBS6382554-02 5x 0.1 mL
IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (Biotin)
Sign In for Pricing
View Details 
K7454805 3x 1.0 µg
Olr1585 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details HY-157715 1 Each
1,2-Dioctanoyl-sn-glycero-3-phospho- (1'-myo-inositol-3',4',5'-trisphosphate) (ammonium)
Sign In for Pricing
View Details M01299-2 100 µL/Vial
Anti-Retinoid X Receptor alpha Rabbit Monoclonal Antibody
Sign In for Pricing
View Details