Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa1 Peptide - C-terminal region

Hoxa1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERA1, Hox-1.6

UniProt

B9EHK7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa1 Rabbit Polyclonal Antibody (orb329906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034579

Preservative

Lyophilized powder

AA Sequence

ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cecropin B
MBS826566-01 1 mg

Cecropin B

Sign In for Pricing
View Details
Cecropin B
MBS826566-02 5 mg

Cecropin B

Sign In for Pricing
View Details
Cecropin B
MBS826566-03 10 mg

Cecropin B

Sign In for Pricing
View Details
Cecropin B
MBS826566-04 5x 10 mg

Cecropin B

Sign In for Pricing
View Details
Rat MIP-3a ELISA kit (4X96T)
LF-EK50674 4×96T

Rat MIP-3a ELISA kit (4X96T)

Sign In for Pricing
View Details
Afatinib Dimaleate
T1773-01 5 mg

Afatinib Dimaleate

Sign In for Pricing
View Details