Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa10 Peptide - C-terminal region

Hoxa10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC188427, RGD1564605, Hoxa10

UniProt

B2RYB5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa10 Rabbit Polyclonal Antibody (orb583897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123350

Preservative

Lyophilized powder

AA Sequence

SVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504622 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human ST8SIA5 activation kit by CRISPRa
GA109303 1 Kit

Human ST8SIA5 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Nitrophenol Sodium Salt Dihydrate
TRC-N504448-2.5G 2.5 g

4-Nitrophenol Sodium Salt Dihydrate

Sign In for Pricing
View Details
PC1/3 (PCSK1) Human Gene Knockout Kit (CRISPR)
KN221711LP 1 Kit

PC1/3 (PCSK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Chloro Imidacloprid
TRC-C366910-10MG 10 mg

5-Chloro Imidacloprid

Sign In for Pricing
View Details
Recombinant Mouse FLRG/Fstl3 Protein (His Tag)
PKSM040903 50 µg

Recombinant Mouse FLRG/Fstl3 Protein (His Tag)

Sign In for Pricing
View Details