Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa10 Peptide - C-terminal region

Hoxa10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC188427, RGD1564605, Hoxa10

UniProt

B2RYB5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa10 Rabbit Polyclonal Antibody (orb583897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123350

Preservative

Lyophilized powder

AA Sequence

SVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA1 Rabbit Polyclonal Antibody
AP06698PU-N 100 µg

HOXA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alpha-Bungarotoxin, CF®405S 100ug
#00002-100ug 1x 100 µg

Alpha-Bungarotoxin, CF®405S 100ug

Sign In for Pricing
View Details
(R)-(-)-3-Quinuclidinol
TRC-Q795785-5G 5 g

(R)-(-)-3-Quinuclidinol

Sign In for Pricing
View Details
Scoparone
TRC-S199980-500MG 500 mg

Scoparone

Sign In for Pricing
View Details
GRB2 (198-217) Rabbit Polyclonal Antibody
AP03043PU-N 100 µg

GRB2 (198-217) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details