HOXB1 Peptide - C-terminal region
HOXB1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845
UniProt
P14653
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HOXB1 Rabbit Polyclonal Antibody (orb576534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002135
Preservative
Lyophilized powder
AA Sequence
FQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
041682-APC 200 µL
SH2D2A, ID (SH2D2A, SCAP, TSAD, VRAP, SH2 domain-containing protein 2A, SH2 domain-containing adapter protein, T cell-specific adapter protein, VEGF receptor-associated protein) (APC) discontinued
Sign In for Pricing
View Details 
MBS9367314-01 48 Well
Camel RWD Domain-Containing Protein 4A (RWDD4A) ELISA Kit
Sign In for Pricing
View Details