Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Peptide - C-terminal region

HOXB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845

UniProt

P14653

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXB1 Rabbit Polyclonal Antibody (orb576534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002135

Preservative

Lyophilized powder

AA Sequence

FQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meig1 AAV siRNA Pooled Vector
28340166 1.0 µg

Meig1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Hsa-miR-374b-5p miRNA Mimic
orb1878080-01 5 nmol

Hsa-miR-374b-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-374b-5p miRNA Mimic
orb1878080-02 10 nmol

Hsa-miR-374b-5p miRNA Mimic

Sign In for Pricing
View Details
(5-Chloro-2-Oxoindoline-3,3-Diyl) Bis (4,1-Phenylene) Diacetate
RG-A263535-01 10 mg

(5-Chloro-2-Oxoindoline-3,3-Diyl) Bis (4,1-Phenylene) Diacetate

Sign In for Pricing
View Details
(5-Chloro-2-Oxoindoline-3,3-Diyl) Bis (4,1-Phenylene) Diacetate
RG-A263535-02 25 mg

(5-Chloro-2-Oxoindoline-3,3-Diyl) Bis (4,1-Phenylene) Diacetate

Sign In for Pricing
View Details
(5-Chloro-2-Oxoindoline-3,3-Diyl) Bis (4,1-Phenylene) Diacetate
RG-A263535-03 50 mg

(5-Chloro-2-Oxoindoline-3,3-Diyl) Bis (4,1-Phenylene) Diacetate

Sign In for Pricing
View Details