Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb13 Peptide - N-terminal region

Hoxb13 Peptide - N-terminal region

Product Specifications

UniProt

P70321

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxb13 Rabbit Polyclonal Antibody (orb329888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032293

Preservative

Lyophilized powder

AA Sequence

MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALE (NM_001127621) Human Over-expression Lysate
LC426826 20 µg

GALE (NM_001127621) Human Over-expression Lysate

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF568 conjugate, 0.1mg/mL
BNC682047-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2690-01 50 μL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2690-02 100 µL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2690-03 1 mL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Smyd1 Mouse Gene Knockout Kit (CRISPR)
KN516362 1 Kit

Smyd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details