Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB3 Peptide - middle region

HOXB3 Peptide - middle region

Product Specifications

Product Name Alternative

HOX2, HOX2G, Hox-2.7

UniProt

P14651

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXB3 Rabbit Polyclonal Antibody (orb583831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002137

Preservative

Lyophilized powder

AA Sequence

SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagNano™ DBCO Upconverting Nanoparticles, Core-Shell, 365 nm/475 nm
DNL-C095 10 mg

DiagNano™ DBCO Upconverting Nanoparticles, Core-Shell, 365 nm/475 nm

Sign In for Pricing
View Details
RAVER2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62675R-BF488-TR 20 µL

RAVER2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Anti-RNF8 Antibody Picoband®, Dylight594 Conjugate
A00707-2-Dylight594 100 µg

Anti-RNF8 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
FGFR4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61509R-BF350-01 20 µL

FGFR4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
FGFR4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61509R-BF350-02 100 µL

FGFR4 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
LAMA5 Antibody
A27281-100UG 100 µg

LAMA5 Antibody

Sign In for Pricing
View Details