HOXB3 Peptide - middle region
HOXB3 Peptide - middle region
Product Specifications
Product Name Alternative
HOX2, HOX2G, Hox-2.7
UniProt
P14651
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HOXB3 Rabbit Polyclonal Antibody (orb583831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002137
Preservative
Lyophilized powder
AA Sequence
SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P4130-02N-ML650 100 µL
PICK1, NT (Protein Interacting with PRKCA 1, Protein Interacting with C Kinase 1, PICK-1, PICK, MGC15204, Protein Kinase C alpha Binding Protein, PRKCA Binding Protein, Prkcabp) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
GTR15326351 1 Vial
Lentiviral human SLC26A3 shRNA (UAS) - Lentiviral human SLC26A3 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
035735-AP 200 µL
FOXI1, ID (FOXI1, FKHL10, FREAC6, Forkhead box protein I1, Forkhead-related protein FKHL10, Forkhead-related transcription factor 6, Hepatocyte nuclear factor 3 forkhead homolog 3) (AP) discontinued
Sign In for Pricing
View Details