Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb7 Peptide - middle region

Hoxb7 Peptide - middle region

Product Specifications

Product Name Alternative

AI325018, Hox-2.3

UniProt

P09024

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxb7 Rabbit Polyclonal Antibody (orb576197) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034590

Preservative

Lyophilized powder

AA Sequence

PGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anserini 1BACE1 ELISA Kit
EAA0671 96 Tests

Anserini 1BACE1 ELISA Kit

Sign In for Pricing
View Details
COG6 Mouse Monoclonal Antibody [Clone ID: OTI4G4]
CF505449 100 µg

COG6 Mouse Monoclonal Antibody [Clone ID: OTI4G4]

Sign In for Pricing
View Details
Cynomolgus / Rhesus Macaque CCR1 EGFP CHO-S Cell Line
E24XCA307 1 Vial

Cynomolgus / Rhesus Macaque CCR1 EGFP CHO-S Cell Line

Sign In for Pricing
View Details
L3MBTL3 (NM_001007102) Human Tagged ORF Clone Lentiviral Particle
RC209288L4V 200 µL

L3MBTL3 (NM_001007102) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sertm1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV645647 1.0 µg DNA

Sertm1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lentiviral mouse Zfp612 shRNA (UAS) - Lentiviral mouse Zfp612 shRNA (UAS, iRFP) (100)
GTR15251523 1 Vial

Lentiviral mouse Zfp612 shRNA (UAS) - Lentiviral mouse Zfp612 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details