Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb7 Peptide - middle region

Hoxb7 Peptide - middle region

Product Specifications

Product Name Alternative

AI325018, Hox-2.3

UniProt

P09024

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxb7 Rabbit Polyclonal Antibody (orb576197) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034590

Preservative

Lyophilized powder

AA Sequence

PGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP4 Rabbit Polyclonal Antibody (Biotin)
orb2099074 100 µL

TIMP4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ADCYAP1R1 ELISA Kit (Mouse) (OKEI00507)
OKEI00507 96 Well

ADCYAP1R1 ELISA Kit (Mouse) (OKEI00507)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Protein CysZ homolog (cysZ), partial
MBS7101865 Inquire

Recombinant Vibrio cholerae serotype O1 Protein CysZ homolog (cysZ), partial

Sign In for Pricing
View Details
p16 (RM267)
MBS370533-01 3 mL (RTU)

p16 (RM267)

Sign In for Pricing
View Details
p16 (RM267)
MBS370533-02 0.1 mL (Concentrate)

p16 (RM267)

Sign In for Pricing
View Details
p16 (RM267)
MBS370533-03 7 mL (RTU)

p16 (RM267)

Sign In for Pricing
View Details