Hoxb9 Peptide - middle region
Hoxb9 Peptide - middle region
Product Specifications
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hoxb9 Rabbit Polyclonal Antibody (orb573983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001093967
Preservative
Lyophilized powder
AA Sequence
SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2417-R 1 Each
MC-24R Refrigerated High Speed Microcentrifuge with COMBI-Rotor, 120V
Sign In for Pricing
View Details 
HAF-471-1 1 mL
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Swine IgG
Sign In for Pricing
View Details 