Hoxb9 Peptide - middle region
Hoxb9 Peptide - middle region
Product Specifications
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hoxb9 Rabbit Polyclonal Antibody (orb573983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001093967
Preservative
Lyophilized powder
AA Sequence
SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3eec13/imageurl/ta500600am.webp)
TA500600AM 100 µL
Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
Sign In for Pricing
View Details 
BNCB0867-500 1x 500 µL
Nuclear Membrane (AE-5), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 