Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb9 Peptide - N-terminal region

Hoxb9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hox-2.5, MGC124051, MGC124052, MGC124053, MGC124054

UniProt

A2A9Z6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxb9 Rabbit Polyclonal Antibody (orb576137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032296

Preservative

Lyophilized powder

AA Sequence

MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC9A6 Rabbit Polyclonal Antibody
AP05295PU-N 100 µg

SLC9A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLR2 Recombinant Rabbit monoclonal Antibody
HA750447 100 µL

TLR2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS706513 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
MBNL1 (NM_207295) Human Over-expression Lysate
LC404078 20 µg

MBNL1 (NM_207295) Human Over-expression Lysate

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF740 conjugate, 0.1mg/mL
BNC742748-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Guinea pig Interleukin 1 Alpha (IL1a) ELISA Kit
RD-IL1a-Gu-01 96 Tests

Guinea pig Interleukin 1 Alpha (IL1a) ELISA Kit

Sign In for Pricing
View Details