Hoxb9 Peptide - N-terminal region
Hoxb9 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Hox-2.5, MGC124051, MGC124052, MGC124053, MGC124054
UniProt
A2A9Z6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hoxb9 Rabbit Polyclonal Antibody (orb576137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032296
Preservative
Lyophilized powder
AA Sequence
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880729-100 1x 100 µL
Ku-Holo (p70;83) (KU729), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-H0213-01 5x 96 Tests
Uncoated Human MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0213-02 15x 96 Tests
Uncoated Human MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit
Sign In for Pricing
View Details 