Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc11 Peptide - C-terminal region

Hoxc11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hox-3.7

UniProt

B9EI74

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc11 Rabbit Polyclonal Antibody (orb576943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020013

Preservative

Lyophilized powder

AA Sequence

NVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRDRLQYFSGNPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (MLANA/788), 0.2mg/mL
BNUB0788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), 0.2mg/mL

Sign In for Pricing
View Details
1,4-Butane-d8-diamine Dihydrochloride
TRC-D416021-25MG 25 mg

1,4-Butane-d8-diamine Dihydrochloride

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560631 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Atp6v0a4 Mouse Gene Knockout Kit (CRISPR)
KN501809 1 Kit

Atp6v0a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vimentin (VM1170), CF647 conjugate, 0.1mg/mL
BNC471170-500 1x 500 µL

Vimentin (VM1170), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABI3BP Polyclonal Antibody
E-AB-14758-01 20 µL

ABI3BP Polyclonal Antibody

Sign In for Pricing
View Details