Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc11 Peptide - C-terminal region

Hoxc11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hox-3.7

UniProt

B9EI74

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc11 Rabbit Polyclonal Antibody (orb576943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020013

Preservative

Lyophilized powder

AA Sequence

NVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRDRLQYFSGNPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG6 Human Gene Knockout Kit (CRISPR)
KN401511 1 Kit

ALG6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-01 20 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-02 100 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-03 500 µg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human B2M/β2-MG Protein (His Tag)
PDEH100690-04 1 mg

Recombinant Human B2M/β2-MG Protein (His Tag)

Sign In for Pricing
View Details
PLK5 Human Gene Knockout Kit (CRISPR)
KN233808LP 1 Kit

PLK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details