Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC6 Peptide - C-terminal region

HOXC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CP25, HHO.C8, HOX3, HOX3C

UniProt

P09630

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HOXC6 Rabbit Polyclonal Antibody (orb576700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_710160

Preservative

Lyophilized powder

AA Sequence

KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated
PKSH033857-01 20 µg

Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details
Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated
PKSH033857-02 100 µg

Recombinant Human BCMA/TNFRSF17 (C-Fc-Avi) Biotinylated

Sign In for Pricing
View Details
COL24A1 Human Gene Knockout Kit (CRISPR)
KN416369 1 Kit

COL24A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCER1G (NM_004106) Human Recombinant Protein
TP307585 20 µg

FCER1G (NM_004106) Human Recombinant Protein

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF740 conjugate, 0.1mg/mL
BNC741203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cell Meter™ Live Cell Caspase 9 Binding Assay Kit *Green Fluorescence*
20117-AAT 25 Tests

Cell Meter™ Live Cell Caspase 9 Binding Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details