Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxd13 Peptide - C-terminal region

Hoxd13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hox-4.8, spdh

UniProt

P70217

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxd13 Rabbit Polyclonal Antibody (orb329631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032301

Preservative

Lyophilized powder

AA Sequence

VPTNEVPARAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR3D, ID (POLR3D, BN51, BN51T, DNA-directed RNA polymerase III subunit RPC4, DNA-directed RNA polymerase III subunit D, Protein BN51, RNA polymerase III 47kD subunit, RPC53 homolog) (MaxLight 750) discontinued
040267-ML750 100 µL

POLR3D, ID (POLR3D, BN51, BN51T, DNA-directed RNA polymerase III subunit RPC4, DNA-directed RNA polymerase III subunit D, Protein BN51, RNA polymerase III 47kD subunit, RPC53 homolog) (MaxLight 750) discontinued

Sign In for Pricing
View Details
pLV2-CMV-VDR-3×FLAG-Puro Plasmid
PVT62797 2 µg

pLV2-CMV-VDR-3×FLAG-Puro Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal FLRT1 Antibody
NBP2-97173-50ul 50 µL

Rabbit Polyclonal FLRT1 Antibody

Sign In for Pricing
View Details
PAK5 Peptide
orb1236739 0.05 mg

PAK5 Peptide

Sign In for Pricing
View Details
Slc39a5 ORF Vector (Mouse) (pORF)
ORF057714 1.0 µg DNA

Slc39a5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CDKL2 Mouse Monoclonal Antibody [Clone ID: LBI1D1]
AMM16973V 100 µL

CDKL2 Mouse Monoclonal Antibody [Clone ID: LBI1D1]

Sign In for Pricing
View Details