Hpcal1 Peptide - C-terminal region
Hpcal1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NVP-3, Nvp3, VILIP3, Vnsl3, Vsnl3
UniProt
P62748
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hpcal1 Rabbit Polyclonal Antibody (orb324751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057886
Preservative
Lyophilized powder
AA Sequence
FSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
169650-01 10 µg
CCL14, Recombinant, Human, His-Tag (C-C Motif Chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1 (1-74), NCC-2, Small-inducible Cytokine A14, NCC2, SCYA14) discontinued
Sign In for Pricing
View Details 169650-02 50 µg
CCL14, Recombinant, Human, His-Tag (C-C Motif Chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1 (1-74), NCC-2, Small-inducible Cytokine A14, NCC2, SCYA14) discontinued
Sign In for Pricing
View Details 
orb1065594 100 µL
Phospho-eIF4EBP1 (Thr70) Rabbit Polyclonal Antibody (Cy7)
Sign In for Pricing
View Details 
GTR15369072 1 Vial
Lentiviral human MEGF11 sgRNA gene knockout kit - Lentiviral human MEGF11 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details